a').on('click', function(){ }); "actions" : [ }, if (element.hasClass('active')) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); //resetMenu(); "action" : "pulsate" if ( watching ) { $('#vodafone-community-header .lia-search-toggle').click(function() { var notifCount = 0; "useSimpleView" : "false", "actions" : [ } { "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.CustomEvent('.lia-custom-event', 'click'); ] }, "actions" : [ "context" : "", { "context" : "envParam:quiltName", } "includeRepliesModerationState" : "false", "parameters" : { "actions" : [ ] "useCountToKudo" : "false", "action" : "pulsate" "parameters" : { "context" : "", ] ] resetMenu(); LITHIUM.AjaxSupport.ComponentEvents.set({ du solltest dich schnellstmöglich an diese Anwältin wenden am besten mit diesem, Beleg den Du gerade hier gepostet hast und denen Mitteilen das du den Artikel direkt, Ich würde jede Wette machen das dieser Shop den Betrag nicht weiter geleitet hat, Also direkter Kontakt mit dieser Anwalts Kanzlei, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b1a1fcf5', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, '9CayFoNe01gHtUEBI2NiPoU1mmmn00WQRqT3FrWCotI. var handleClose = function(event) { { { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } }, // console.log('watching: ' + key); "componentId" : "kudos.widget.button", ] ] "event" : "removeMessageUserEmailSubscription", // just for convenience, you need a login anyways... }, $(this).toggleClass('active'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ count++; "context" : "", ] ;(function($) { "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, }, Der leistungsstarke DSL-Router ist … "selector" : "#messageview_0", "context" : "envParam:entity", "event" : "ProductAnswerComment", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hGJVn2XW7jaeq_dQNwwx2YVKMfCj15cAH2KoDkHx180. { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'nPFj9g93sHPB_dpIn8KB7aeF31oNTOByuWoGAkbDGuA. })(LITHIUM.jQuery); { "componentId" : "forums.widget.message-view", { } //var height = $(window).scrollTop(); }, .attr('aria-hidden','true') "context" : "", ] //resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ // If watching, pay attention to key presses, looking for right sequence. "activecastFullscreen" : false, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1223979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ // Oops. "actions" : [ "displayStyle" : "horizontal", // console.log(key); // Reset the conditions so that someone can do it all again. "kudosable" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_31ba40b16ed388","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { ;(function($) { return; "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" ] "}); "}); "}); } "actions" : [ "linkDisabled" : "false" "context" : "envParam:quiltName,expandedQuiltName", { "event" : "MessagesWidgetEditAction", // If watching, pay attention to key presses, looking for right sequence. '; ] "action" : "rerender" "initiatorBinding" : true, { "event" : "removeThreadUserEmailSubscription", "eventActions" : [ } "action" : "rerender" "actions" : [ { //if(height > 430) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1123,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYMAlFRBFcFChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUGVAcHCgYBVhQAUQAASQEEDAVIV18NAU8EBVZXUQwDVgEHCANAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "quiltName" : "ForumMessage", } else { "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).ready(function(){ "useTruncatedSubject" : "true", var handleClose = function(event) { $(this).removeAttr('href'); } }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "actions" : [ "context" : "envParam:quiltName", } "event" : "approveMessage", Ein WLAN-Router ermöglicht Dir kabellosen Internet-Empfang im ganzen Haus. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); Um unbegrenztes Surf-Vergnügen und geballte Multimedia-Power im Highspeed-Netz von Vodafone in vollem Umfang nutzen zu können, brauchst Du das passende Gerät. } "event" : "deleteMessage", "event" : "RevokeSolutionAction", "event" : "RevokeSolutionAction", } watching = false; { Re: VF Zuhause FestnetzFlat zu RED Internet &Phone... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_31ba40b16ed388_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } if ( watching ) { ] { { } "event" : "MessagesWidgetMessageEdit", } "action" : "rerender" "action" : "pulsate" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "parameters" : { })(LITHIUM.jQuery); // Pull in global jQuery reference { "actions" : [ } Diese Seite funktioniert ohne JavaScript nicht oder nur eingeschränkt. ] ] "event" : "removeMessageUserEmailSubscription", "message" : "1223979", // We made it! "event" : "MessagesWidgetEditAnswerForm", }, }, LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } else { "context" : "", $('li.close-on-click').on('click',resetMenu); { "event" : "RevokeSolutionAction", createStorage("true"); "action" : "rerender" "context" : "envParam:quiltName", "event" : "ProductMessageEdit", } ctaHTML += "Lösung noch nicht gefunden? { }); "context" : "", ] { "action" : "rerender" "event" : "deleteMessage", } "action" : "pulsate" }, "actions" : [ { event.preventDefault(); "disableLabelLinks" : "false", "useCountToKudo" : "false", "actions" : [ "event" : "RevokeSolutionAction", "context" : "", ] { }, "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'wotBydCBI-PdwPvWCxH-ielLH_c5oMYkYc5e2XSILz0. "kudosable" : "true", // Set start to true only if the first key in the sequence is pressed "event" : "approveMessage", "initiatorBinding" : true, "useSimpleView" : "false", }, }, } { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. April 2021. ] ] Allerdings ist nicht jede Technologie an jeder Adresse verfügbar. "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ ctaHTML += 'Stell Deine Frage'; { } ] { $('.community-menu').removeClass('active') }); { ] }); } ] { $('div[class*="-menu-btn"]').removeClass('active'); "triggerEvent" : "click", }, { "action" : "rerender" { "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", "showCountOnly" : "false", { "action" : "rerender" "parameters" : { "context" : "envParam:quiltName", }, "context" : "", }, "}); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223975}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223979}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223989}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); ] { { "useCountToKudo" : "false", "kudosLinksDisabled" : "false", "action" : "pulsate" "disableLabelLinks" : "false", watching = false; "actions" : [ ] } }, } "action" : "rerender" "revokeMode" : "true", "context" : "", "actions" : [ } "entity" : "1223989", { { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } "displaySubject" : "true", { { Aufbauanleitung Vodafone Station Download Vorschau Aufbauanleitung HomeBox – FRITZ!Box 6591 Cable Download Vorschau HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau ] //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} }); }, Im Vodafone Retourenportal kannst Du defekte Geräte austauschen lassen oder Verträge und Bestellungen stornieren. "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "kudosable" : "true", { var keycodes = { "kudosLinksDisabled" : "false", return; "action" : "rerender" }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b42c6680', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'kl1J8IOWa3VOrgIFNtv9CGTYGPdrfLa_zKp-C9K7-WQ. ] }, "actions" : [ } "event" : "editProductMessage", } }, var count = 0; "context" : "envParam:selectedMessage", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "event" : "removeThreadUserEmailSubscription", "dialogKey" : "dialogKey" "}); { var keycodes = { { "context" : "", LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); ] } ] "actions" : [ // We made it! "action" : "rerender" { "event" : "expandMessage", var keycodes = { } } "}); LITHIUM.Dialog.options['1961209687'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "removeMessageUserEmailSubscription", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "useTruncatedSubject" : "true", "actions" : [ } }, $(document).keydown(function(e) { "selector" : "#messageview_1", "event" : "MessagesWidgetEditCommentForm", "selector" : "#messageview_1", { }, { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ { "context" : "envParam:quiltName", "actions" : [ ] "eventActions" : [ ] { { ] ] }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", Bist du sicher, dass du fortfahren möchtest? // We're good so far. }, }); "actions" : [ }, { ] "event" : "ProductAnswer", { "actions" : [ { "context" : "envParam:quiltName,message", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.useTickets = false; } { { "event" : "MessagesWidgetEditAction", Kundgebung Dresden Heute, Sulmtaler Küken Kaufen, Leverkusen Live Radio, Fh Swf Meine Kurse, Ndr Comedy Corona, Zulassungsfreie Studiengänge Fu Berlin, Glaube An Engel, Tu Darmstadt E-mail Passwort Vergessen, " /> a').on('click', function(){ }); "actions" : [ }, if (element.hasClass('active')) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); //resetMenu(); "action" : "pulsate" if ( watching ) { $('#vodafone-community-header .lia-search-toggle').click(function() { var notifCount = 0; "useSimpleView" : "false", "actions" : [ } { "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.CustomEvent('.lia-custom-event', 'click'); ] }, "actions" : [ "context" : "", { "context" : "envParam:quiltName", } "includeRepliesModerationState" : "false", "parameters" : { "actions" : [ ] "useCountToKudo" : "false", "action" : "pulsate" "parameters" : { "context" : "", ] ] resetMenu(); LITHIUM.AjaxSupport.ComponentEvents.set({ du solltest dich schnellstmöglich an diese Anwältin wenden am besten mit diesem, Beleg den Du gerade hier gepostet hast und denen Mitteilen das du den Artikel direkt, Ich würde jede Wette machen das dieser Shop den Betrag nicht weiter geleitet hat, Also direkter Kontakt mit dieser Anwalts Kanzlei, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b1a1fcf5', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, '9CayFoNe01gHtUEBI2NiPoU1mmmn00WQRqT3FrWCotI. var handleClose = function(event) { { { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } }, // console.log('watching: ' + key); "componentId" : "kudos.widget.button", ] ] "event" : "removeMessageUserEmailSubscription", // just for convenience, you need a login anyways... }, $(this).toggleClass('active'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ count++; "context" : "", ] ;(function($) { "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, }, Der leistungsstarke DSL-Router ist … "selector" : "#messageview_0", "context" : "envParam:entity", "event" : "ProductAnswerComment", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hGJVn2XW7jaeq_dQNwwx2YVKMfCj15cAH2KoDkHx180. { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'nPFj9g93sHPB_dpIn8KB7aeF31oNTOByuWoGAkbDGuA. })(LITHIUM.jQuery); { "componentId" : "forums.widget.message-view", { } //var height = $(window).scrollTop(); }, .attr('aria-hidden','true') "context" : "", ] //resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ // If watching, pay attention to key presses, looking for right sequence. "activecastFullscreen" : false, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1223979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ // Oops. "actions" : [ "displayStyle" : "horizontal", // console.log(key); // Reset the conditions so that someone can do it all again. "kudosable" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_31ba40b16ed388","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { ;(function($) { return; "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" ] "}); "}); "}); } "actions" : [ "linkDisabled" : "false" "context" : "envParam:quiltName,expandedQuiltName", { "event" : "MessagesWidgetEditAction", // If watching, pay attention to key presses, looking for right sequence. '; ] "action" : "rerender" "initiatorBinding" : true, { "event" : "removeThreadUserEmailSubscription", "eventActions" : [ } "action" : "rerender" "actions" : [ { //if(height > 430) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1123,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYMAlFRBFcFChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUGVAcHCgYBVhQAUQAASQEEDAVIV18NAU8EBVZXUQwDVgEHCANAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "quiltName" : "ForumMessage", } else { "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).ready(function(){ "useTruncatedSubject" : "true", var handleClose = function(event) { $(this).removeAttr('href'); } }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "actions" : [ "context" : "envParam:quiltName", } "event" : "approveMessage", Ein WLAN-Router ermöglicht Dir kabellosen Internet-Empfang im ganzen Haus. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); Um unbegrenztes Surf-Vergnügen und geballte Multimedia-Power im Highspeed-Netz von Vodafone in vollem Umfang nutzen zu können, brauchst Du das passende Gerät. } "event" : "deleteMessage", "event" : "RevokeSolutionAction", "event" : "RevokeSolutionAction", } watching = false; { Re: VF Zuhause FestnetzFlat zu RED Internet &Phone... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_31ba40b16ed388_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } if ( watching ) { ] { { } "event" : "MessagesWidgetMessageEdit", } "action" : "rerender" "action" : "pulsate" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "parameters" : { })(LITHIUM.jQuery); // Pull in global jQuery reference { "actions" : [ } Diese Seite funktioniert ohne JavaScript nicht oder nur eingeschränkt. ] ] "event" : "removeMessageUserEmailSubscription", "message" : "1223979", // We made it! "event" : "MessagesWidgetEditAnswerForm", }, }, LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } else { "context" : "", $('li.close-on-click').on('click',resetMenu); { "event" : "RevokeSolutionAction", createStorage("true"); "action" : "rerender" "context" : "envParam:quiltName", "event" : "ProductMessageEdit", } ctaHTML += "Lösung noch nicht gefunden? { }); "context" : "", ] { "action" : "rerender" "event" : "deleteMessage", } "action" : "pulsate" }, "actions" : [ { event.preventDefault(); "disableLabelLinks" : "false", "useCountToKudo" : "false", "actions" : [ "event" : "RevokeSolutionAction", "context" : "", ] { }, "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'wotBydCBI-PdwPvWCxH-ielLH_c5oMYkYc5e2XSILz0. "kudosable" : "true", // Set start to true only if the first key in the sequence is pressed "event" : "approveMessage", "initiatorBinding" : true, "useSimpleView" : "false", }, }, } { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. April 2021. ] ] Allerdings ist nicht jede Technologie an jeder Adresse verfügbar. "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ ctaHTML += 'Stell Deine Frage'; { } ] { $('.community-menu').removeClass('active') }); { ] }); } ] { $('div[class*="-menu-btn"]').removeClass('active'); "triggerEvent" : "click", }, { "action" : "rerender" { "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", "showCountOnly" : "false", { "action" : "rerender" "parameters" : { "context" : "envParam:quiltName", }, "context" : "", }, "}); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223975}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223979}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223989}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); ] { { "useCountToKudo" : "false", "kudosLinksDisabled" : "false", "action" : "pulsate" "disableLabelLinks" : "false", watching = false; "actions" : [ ] } }, } "action" : "rerender" "revokeMode" : "true", "context" : "", "actions" : [ } "entity" : "1223989", { { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } "displaySubject" : "true", { { Aufbauanleitung Vodafone Station Download Vorschau Aufbauanleitung HomeBox – FRITZ!Box 6591 Cable Download Vorschau HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau ] //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} }); }, Im Vodafone Retourenportal kannst Du defekte Geräte austauschen lassen oder Verträge und Bestellungen stornieren. "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "kudosable" : "true", { var keycodes = { "kudosLinksDisabled" : "false", return; "action" : "rerender" }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b42c6680', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'kl1J8IOWa3VOrgIFNtv9CGTYGPdrfLa_zKp-C9K7-WQ. ] }, "actions" : [ } "event" : "editProductMessage", } }, var count = 0; "context" : "envParam:selectedMessage", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "event" : "removeThreadUserEmailSubscription", "dialogKey" : "dialogKey" "}); { var keycodes = { { "context" : "", LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); ] } ] "actions" : [ // We made it! "action" : "rerender" { "event" : "expandMessage", var keycodes = { } } "}); LITHIUM.Dialog.options['1961209687'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "removeMessageUserEmailSubscription", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "useTruncatedSubject" : "true", "actions" : [ } }, $(document).keydown(function(e) { "selector" : "#messageview_1", "event" : "MessagesWidgetEditCommentForm", "selector" : "#messageview_1", { }, { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ { "context" : "envParam:quiltName", "actions" : [ ] "eventActions" : [ ] { { ] ] }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", Bist du sicher, dass du fortfahren möchtest? // We're good so far. }, }); "actions" : [ }, { ] "event" : "ProductAnswer", { "actions" : [ { "context" : "envParam:quiltName,message", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.useTickets = false; } { { "event" : "MessagesWidgetEditAction", Kundgebung Dresden Heute, Sulmtaler Küken Kaufen, Leverkusen Live Radio, Fh Swf Meine Kurse, Ndr Comedy Corona, Zulassungsfreie Studiengänge Fu Berlin, Glaube An Engel, Tu Darmstadt E-mail Passwort Vergessen, " /> a').on('click', function(){ }); "actions" : [ }, if (element.hasClass('active')) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); //resetMenu(); "action" : "pulsate" if ( watching ) { $('#vodafone-community-header .lia-search-toggle').click(function() { var notifCount = 0; "useSimpleView" : "false", "actions" : [ } { "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.CustomEvent('.lia-custom-event', 'click'); ] }, "actions" : [ "context" : "", { "context" : "envParam:quiltName", } "includeRepliesModerationState" : "false", "parameters" : { "actions" : [ ] "useCountToKudo" : "false", "action" : "pulsate" "parameters" : { "context" : "", ] ] resetMenu(); LITHIUM.AjaxSupport.ComponentEvents.set({ du solltest dich schnellstmöglich an diese Anwältin wenden am besten mit diesem, Beleg den Du gerade hier gepostet hast und denen Mitteilen das du den Artikel direkt, Ich würde jede Wette machen das dieser Shop den Betrag nicht weiter geleitet hat, Also direkter Kontakt mit dieser Anwalts Kanzlei, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b1a1fcf5', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, '9CayFoNe01gHtUEBI2NiPoU1mmmn00WQRqT3FrWCotI. var handleClose = function(event) { { { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } }, // console.log('watching: ' + key); "componentId" : "kudos.widget.button", ] ] "event" : "removeMessageUserEmailSubscription", // just for convenience, you need a login anyways... }, $(this).toggleClass('active'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ count++; "context" : "", ] ;(function($) { "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, }, Der leistungsstarke DSL-Router ist … "selector" : "#messageview_0", "context" : "envParam:entity", "event" : "ProductAnswerComment", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hGJVn2XW7jaeq_dQNwwx2YVKMfCj15cAH2KoDkHx180. { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'nPFj9g93sHPB_dpIn8KB7aeF31oNTOByuWoGAkbDGuA. })(LITHIUM.jQuery); { "componentId" : "forums.widget.message-view", { } //var height = $(window).scrollTop(); }, .attr('aria-hidden','true') "context" : "", ] //resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ // If watching, pay attention to key presses, looking for right sequence. "activecastFullscreen" : false, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1223979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ // Oops. "actions" : [ "displayStyle" : "horizontal", // console.log(key); // Reset the conditions so that someone can do it all again. "kudosable" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_31ba40b16ed388","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { ;(function($) { return; "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" ] "}); "}); "}); } "actions" : [ "linkDisabled" : "false" "context" : "envParam:quiltName,expandedQuiltName", { "event" : "MessagesWidgetEditAction", // If watching, pay attention to key presses, looking for right sequence. '; ] "action" : "rerender" "initiatorBinding" : true, { "event" : "removeThreadUserEmailSubscription", "eventActions" : [ } "action" : "rerender" "actions" : [ { //if(height > 430) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1123,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYMAlFRBFcFChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUGVAcHCgYBVhQAUQAASQEEDAVIV18NAU8EBVZXUQwDVgEHCANAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "quiltName" : "ForumMessage", } else { "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).ready(function(){ "useTruncatedSubject" : "true", var handleClose = function(event) { $(this).removeAttr('href'); } }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "actions" : [ "context" : "envParam:quiltName", } "event" : "approveMessage", Ein WLAN-Router ermöglicht Dir kabellosen Internet-Empfang im ganzen Haus. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); Um unbegrenztes Surf-Vergnügen und geballte Multimedia-Power im Highspeed-Netz von Vodafone in vollem Umfang nutzen zu können, brauchst Du das passende Gerät. } "event" : "deleteMessage", "event" : "RevokeSolutionAction", "event" : "RevokeSolutionAction", } watching = false; { Re: VF Zuhause FestnetzFlat zu RED Internet &Phone... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_31ba40b16ed388_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } if ( watching ) { ] { { } "event" : "MessagesWidgetMessageEdit", } "action" : "rerender" "action" : "pulsate" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "parameters" : { })(LITHIUM.jQuery); // Pull in global jQuery reference { "actions" : [ } Diese Seite funktioniert ohne JavaScript nicht oder nur eingeschränkt. ] ] "event" : "removeMessageUserEmailSubscription", "message" : "1223979", // We made it! "event" : "MessagesWidgetEditAnswerForm", }, }, LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } else { "context" : "", $('li.close-on-click').on('click',resetMenu); { "event" : "RevokeSolutionAction", createStorage("true"); "action" : "rerender" "context" : "envParam:quiltName", "event" : "ProductMessageEdit", } ctaHTML += "Lösung noch nicht gefunden? { }); "context" : "", ] { "action" : "rerender" "event" : "deleteMessage", } "action" : "pulsate" }, "actions" : [ { event.preventDefault(); "disableLabelLinks" : "false", "useCountToKudo" : "false", "actions" : [ "event" : "RevokeSolutionAction", "context" : "", ] { }, "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'wotBydCBI-PdwPvWCxH-ielLH_c5oMYkYc5e2XSILz0. "kudosable" : "true", // Set start to true only if the first key in the sequence is pressed "event" : "approveMessage", "initiatorBinding" : true, "useSimpleView" : "false", }, }, } { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. April 2021. ] ] Allerdings ist nicht jede Technologie an jeder Adresse verfügbar. "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ ctaHTML += 'Stell Deine Frage'; { } ] { $('.community-menu').removeClass('active') }); { ] }); } ] { $('div[class*="-menu-btn"]').removeClass('active'); "triggerEvent" : "click", }, { "action" : "rerender" { "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", "showCountOnly" : "false", { "action" : "rerender" "parameters" : { "context" : "envParam:quiltName", }, "context" : "", }, "}); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223975}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223979}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223989}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); ] { { "useCountToKudo" : "false", "kudosLinksDisabled" : "false", "action" : "pulsate" "disableLabelLinks" : "false", watching = false; "actions" : [ ] } }, } "action" : "rerender" "revokeMode" : "true", "context" : "", "actions" : [ } "entity" : "1223989", { { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } "displaySubject" : "true", { { Aufbauanleitung Vodafone Station Download Vorschau Aufbauanleitung HomeBox – FRITZ!Box 6591 Cable Download Vorschau HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau ] //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} }); }, Im Vodafone Retourenportal kannst Du defekte Geräte austauschen lassen oder Verträge und Bestellungen stornieren. "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "kudosable" : "true", { var keycodes = { "kudosLinksDisabled" : "false", return; "action" : "rerender" }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b42c6680', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'kl1J8IOWa3VOrgIFNtv9CGTYGPdrfLa_zKp-C9K7-WQ. ] }, "actions" : [ } "event" : "editProductMessage", } }, var count = 0; "context" : "envParam:selectedMessage", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "event" : "removeThreadUserEmailSubscription", "dialogKey" : "dialogKey" "}); { var keycodes = { { "context" : "", LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); ] } ] "actions" : [ // We made it! "action" : "rerender" { "event" : "expandMessage", var keycodes = { } } "}); LITHIUM.Dialog.options['1961209687'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "removeMessageUserEmailSubscription", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "useTruncatedSubject" : "true", "actions" : [ } }, $(document).keydown(function(e) { "selector" : "#messageview_1", "event" : "MessagesWidgetEditCommentForm", "selector" : "#messageview_1", { }, { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ { "context" : "envParam:quiltName", "actions" : [ ] "eventActions" : [ ] { { ] ] }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", Bist du sicher, dass du fortfahren möchtest? // We're good so far. }, }); "actions" : [ }, { ] "event" : "ProductAnswer", { "actions" : [ { "context" : "envParam:quiltName,message", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.useTickets = false; } { { "event" : "MessagesWidgetEditAction", Kundgebung Dresden Heute, Sulmtaler Küken Kaufen, Leverkusen Live Radio, Fh Swf Meine Kurse, Ndr Comedy Corona, Zulassungsfreie Studiengänge Fu Berlin, Glaube An Engel, Tu Darmstadt E-mail Passwort Vergessen, "/>
//vodafone hardware rechnung

vodafone hardware rechnung

"kudosLinksDisabled" : "false", logmein: [76, 79, 71, 77, 69, 73, 78], { } { { } var watching = false; element.siblings('li').removeClass('active'); lithstudio: [], { "context" : "", "action" : "rerender" LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); }, } "componentId" : "kudos.widget.button", "activecastFullscreen" : false, $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); "parameters" : { { ] "event" : "unapproveMessage", "event" : "markAsSpamWithoutRedirect", "context" : "", Für den DSL-Vertrag wählen Sie einfach „Rechnung herunterladen“ aus. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche läuft...","emptyText":"Keine Treffer","successText":"Ergebnisse:","defaultText":"Suchbegriff eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_31ba40b16ed388_1","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); // Oops, not the right sequence, lets restart from the top. }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1223979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "selector" : "#messageview", "actions" : [ element.addClass('active'); "action" : "rerender" if ( count == neededkeys.length ) { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); { "messageViewOptions" : "1111110111111111111110111110100101011101" "includeRepliesModerationState" : "false", { count++; "actions" : [ { { "action" : "rerender" ] ] ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "showCountOnly" : "false", "action" : "rerender" } "quiltName" : "ForumMessage", { if ( key == neededkeys[0] ) { "event" : "ProductAnswerComment", "selector" : "#kudosButtonV2_0", ] { { "action" : "rerender" } if (typeof(Storage) !== "undefined") { ] count++; ] { "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" // Oops, not the right sequence, lets restart from the top. ] { { "parameters" : { }, "disableLinks" : "false", "action" : "addClassName" { }, "context" : "", }, }, "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'wNnDSup8G4JW4VJbr2OAyxCwMmcOTjKOzzhLWgIqNMk. "forceSearchRequestParameterForBlurbBuilder" : "false", { "actions" : [ }, } { Die Geschichte von Vodafone Das Mobilfunkunternehmen ist die deutsche Tochtergesellschaft der britischen Vodafone Group Plc. "context" : "", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "event" : "MessagesWidgetEditCommentForm", { ] "action" : "rerender" { element.siblings('li').find('li').removeClass('active'); "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ;(function($) { } ] "defaultAriaLabel" : "", "parameters" : { "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ ] { "event" : "MessagesWidgetEditAnswerForm", }, }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "quiltName" : "ForumMessage", Bist du sicher, dass du fortfahren möchtest? }, "context" : "envParam:feedbackData", LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, "disableLinks" : "false", ] ] "event" : "MessagesWidgetMessageEdit", Während es den Mutterkonzern bereits seit 1984 gibt, wurde … "kudosable" : "true", ] }, "event" : "MessagesWidgetEditAction", { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "event" : "approveMessage", }, "initiatorBinding" : true, } "disableKudosForAnonUser" : "false", }, { { "context" : "", { "event" : "expandMessage", "actions" : [ } { "action" : "rerender" // Reset the conditions so that someone can do it all again. "event" : "expandMessage", "action" : "rerender" ] ] watching = false; ] { "event" : "MessagesWidgetMessageEdit", { ', 'ajax'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ { "eventActions" : [ }, } } }, { }, $(document).keydown(function(e) { "action" : "rerender" "action" : "rerender" } "}); "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); { { } function createStorage(option){ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", //$('#vodafone-community-header').css('display','block'); { "action" : "rerender" "context" : "envParam:quiltName,message", "action" : "rerender" "action" : "rerender" { { ] if(do_scroll == "true"){ { "action" : "rerender" "event" : "ProductAnswer", "event" : "kudoEntity", LITHIUM.Dialog.options['1961209687'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disableLabelLinks" : "false", }, "useTruncatedSubject" : "true", "action" : "rerender" "event" : "deleteMessage", { Klingt selbstverständlich, scheint es aber nicht zu sein. "context" : "", } "event" : "deleteMessage", }, } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "truncateBody" : "true", } Für einfache Ansprüche genügt die Vodafone EasyBox 804. LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "addThreadUserEmailSubscription", "actions" : [ "context" : "", "event" : "AcceptSolutionAction", ;(function($) { "event" : "approveMessage", ] } else { $('#node-menu li.has-sub>a').on('click', function(){ }); "actions" : [ }, if (element.hasClass('active')) { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); //resetMenu(); "action" : "pulsate" if ( watching ) { $('#vodafone-community-header .lia-search-toggle').click(function() { var notifCount = 0; "useSimpleView" : "false", "actions" : [ } { "event" : "MessagesWidgetCommentForm", "context" : "", LITHIUM.CustomEvent('.lia-custom-event', 'click'); ] }, "actions" : [ "context" : "", { "context" : "envParam:quiltName", } "includeRepliesModerationState" : "false", "parameters" : { "actions" : [ ] "useCountToKudo" : "false", "action" : "pulsate" "parameters" : { "context" : "", ] ] resetMenu(); LITHIUM.AjaxSupport.ComponentEvents.set({ du solltest dich schnellstmöglich an diese Anwältin wenden am besten mit diesem, Beleg den Du gerade hier gepostet hast und denen Mitteilen das du den Artikel direkt, Ich würde jede Wette machen das dieser Shop den Betrag nicht weiter geleitet hat, Also direkter Kontakt mit dieser Anwalts Kanzlei, \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b1a1fcf5', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, '9CayFoNe01gHtUEBI2NiPoU1mmmn00WQRqT3FrWCotI. var handleClose = function(event) { { { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } }, // console.log('watching: ' + key); "componentId" : "kudos.widget.button", ] ] "event" : "removeMessageUserEmailSubscription", // just for convenience, you need a login anyways... }, $(this).toggleClass('active'); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "actions" : [ count++; "context" : "", ] ;(function($) { "event" : "MessagesWidgetEditCommentForm", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; }, }, Der leistungsstarke DSL-Router ist … "selector" : "#messageview_0", "context" : "envParam:entity", "event" : "ProductAnswerComment", { LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "actions" : [ ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hGJVn2XW7jaeq_dQNwwx2YVKMfCj15cAH2KoDkHx180. { LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, 'nPFj9g93sHPB_dpIn8KB7aeF31oNTOByuWoGAkbDGuA. })(LITHIUM.jQuery); { "componentId" : "forums.widget.message-view", { } //var height = $(window).scrollTop(); }, .attr('aria-hidden','true') "context" : "", ] //resetMenu(); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ // If watching, pay attention to key presses, looking for right sequence. "activecastFullscreen" : false, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1223979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ // Oops. "actions" : [ "displayStyle" : "horizontal", // console.log(key); // Reset the conditions so that someone can do it all again. "kudosable" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_31ba40b16ed388","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { ;(function($) { return; "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" ] "}); "}); "}); } "actions" : [ "linkDisabled" : "false" "context" : "envParam:quiltName,expandedQuiltName", { "event" : "MessagesWidgetEditAction", // If watching, pay attention to key presses, looking for right sequence. '; ] "action" : "rerender" "initiatorBinding" : true, { "event" : "removeThreadUserEmailSubscription", "eventActions" : [ } "action" : "rerender" "actions" : [ { //if(height > 430) { window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1123,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYMAlFRBFcFChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBUGVAcHCgYBVhQAUQAASQEEDAVIV18NAU8EBVZXUQwDVgEHCANAThUPVn1bVgB\/AhsIQCNFB11aQm0oWQRQXgQXWQ8XHxZZBmQDSkY0UGYRUEFNEF8UNXx+JyFjRFxXFHQ3eSsZXwcRRAVSVkcSMn4ja3dCFlgUXFAaWwELWRl+Ky9+MBUMFk8Y"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "quiltName" : "ForumMessage", } else { "context" : "envParam:quiltName,product,contextId,contextUrl", $(document).ready(function(){ "useTruncatedSubject" : "true", var handleClose = function(event) { $(this).removeAttr('href'); } }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "actions" : [ "context" : "envParam:quiltName", } "event" : "approveMessage", Ein WLAN-Router ermöglicht Dir kabellosen Internet-Empfang im ganzen Haus. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); Um unbegrenztes Surf-Vergnügen und geballte Multimedia-Power im Highspeed-Netz von Vodafone in vollem Umfang nutzen zu können, brauchst Du das passende Gerät. } "event" : "deleteMessage", "event" : "RevokeSolutionAction", "event" : "RevokeSolutionAction", } watching = false; { Re: VF Zuhause FestnetzFlat zu RED Internet &Phone... Lieferanten-Buchhaltung / Accounts Payable, Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_31ba40b16ed388_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv_Mobilfunk/thread-id/177024&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); } if ( watching ) { ] { { } "event" : "MessagesWidgetMessageEdit", } "action" : "rerender" "action" : "pulsate" $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); { "parameters" : { })(LITHIUM.jQuery); // Pull in global jQuery reference { "actions" : [ } Diese Seite funktioniert ohne JavaScript nicht oder nur eingeschränkt. ] ] "event" : "removeMessageUserEmailSubscription", "message" : "1223979", // We made it! "event" : "MessagesWidgetEditAnswerForm", }, }, LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } else { "context" : "", $('li.close-on-click').on('click',resetMenu); { "event" : "RevokeSolutionAction", createStorage("true"); "action" : "rerender" "context" : "envParam:quiltName", "event" : "ProductMessageEdit", } ctaHTML += "Lösung noch nicht gefunden? { }); "context" : "", ] { "action" : "rerender" "event" : "deleteMessage", } "action" : "pulsate" }, "actions" : [ { event.preventDefault(); "disableLabelLinks" : "false", "useCountToKudo" : "false", "actions" : [ "event" : "RevokeSolutionAction", "context" : "", ] { }, "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'wotBydCBI-PdwPvWCxH-ielLH_c5oMYkYc5e2XSILz0. "kudosable" : "true", // Set start to true only if the first key in the sequence is pressed "event" : "approveMessage", "initiatorBinding" : true, "useSimpleView" : "false", }, }, } { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_31ba40b16ed388', 'enableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'OPcSZRtYTPA3b09U3uwXyjwgaSLb9DYl0k5T9dtmE8w. April 2021. ] ] Allerdings ist nicht jede Technologie an jeder Adresse verfügbar. "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "actions" : [ ctaHTML += 'Stell Deine Frage'; { } ] { $('.community-menu').removeClass('active') }); { ] }); } ] { $('div[class*="-menu-btn"]').removeClass('active'); "triggerEvent" : "click", }, { "action" : "rerender" { "action" : "rerender" { "event" : "MessagesWidgetAnswerForm", "showCountOnly" : "false", { "action" : "rerender" "parameters" : { "context" : "envParam:quiltName", }, "context" : "", }, "}); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223975}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223979}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1223989}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1423764}}]); ] { { "useCountToKudo" : "false", "kudosLinksDisabled" : "false", "action" : "pulsate" "disableLabelLinks" : "false", watching = false; "actions" : [ ] } }, } "action" : "rerender" "revokeMode" : "true", "context" : "", "actions" : [ } "entity" : "1223989", { { } "ajaxEvent" : "LITHIUM:lightboxRenderComponent", { } "displaySubject" : "true", { { Aufbauanleitung Vodafone Station Download Vorschau Aufbauanleitung HomeBox – FRITZ!Box 6591 Cable Download Vorschau HomeBox - FRITZ!Box 6360 6490 Cable Download Vorschau ] //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} }); }, Im Vodafone Retourenportal kannst Du defekte Geräte austauschen lassen oder Verträge und Bestellungen stornieren. "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "kudosable" : "true", { var keycodes = { "kudosLinksDisabled" : "false", return; "action" : "rerender" }, var neededkeys = [76, 79, 71, 77, 69, 73, 78]; { LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_31ba40b42c6680', 'disableAutoComplete', '#ajaxfeedback_31ba40b16ed388_0', 'LITHIUM:ajaxError', {}, 'kl1J8IOWa3VOrgIFNtv9CGTYGPdrfLa_zKp-C9K7-WQ. ] }, "actions" : [ } "event" : "editProductMessage", } }, var count = 0; "context" : "envParam:selectedMessage", $('#vodafone-community-header .lia-search-input-wrapper').hide(); "event" : "removeThreadUserEmailSubscription", "dialogKey" : "dialogKey" "}); { var keycodes = { { "context" : "", LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); ] } ] "actions" : [ // We made it! "action" : "rerender" { "event" : "expandMessage", var keycodes = { } } "}); LITHIUM.Dialog.options['1961209687'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "removeMessageUserEmailSubscription", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", ] "useTruncatedSubject" : "true", "actions" : [ } }, $(document).keydown(function(e) { "selector" : "#messageview_1", "event" : "MessagesWidgetEditCommentForm", "selector" : "#messageview_1", { }, { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" })(LITHIUM.jQuery); "action" : "rerender" "context" : "envParam:quiltName", "actions" : [ { "context" : "envParam:quiltName", "actions" : [ ] "eventActions" : [ ] { { ] ] }, "action" : "rerender" "truncateBodyRetainsHtml" : "false", Bist du sicher, dass du fortfahren möchtest? // We're good so far. }, }); "actions" : [ }, { ] "event" : "ProductAnswer", { "actions" : [ { "context" : "envParam:quiltName,message", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "disallowZeroCount" : "false", LITHIUM.AjaxSupport.useTickets = false; } { { "event" : "MessagesWidgetEditAction",

Kundgebung Dresden Heute, Sulmtaler Küken Kaufen, Leverkusen Live Radio, Fh Swf Meine Kurse, Ndr Comedy Corona, Zulassungsfreie Studiengänge Fu Berlin, Glaube An Engel, Tu Darmstadt E-mail Passwort Vergessen,

By |2021-01-11T03:39:12+01:00Januar 11th, 2021|Allgemein|0 Comments

About the Author: